PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G228800.3
Common NameB456_008G228800, LOC105765034
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARR-B
Protein Properties Length: 563aa    MW: 62173.1 Da    PI: 6.59
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G228800.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like85.65.1e-27317371156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k +++Wtp LH++Fv+av+qL G+++A+P++ilelmk++gLt+++v+SHLQkYR++
  Gorai.008G228800.3 317 KSKVDWTPALHKKFVQAVDQL-GIDQAIPSRILELMKIEGLTRHNVASHLQKYRMH 371
                         6799*****************.********************************96 PP

2Response_reg27.51.6e-10201261109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl+ d++ + ++ l++ le  +y +v ++ +  eal  +  +   +++ ++ i+  + +G+  +k +++++ +lp i+ +     +++ ++
  Gorai.008G228800.3  20 VLLLDEDSNSASELKSKLEAMDY-IVYTFCNENEALSAVSSRPesFHVAIVEINTNKKNGS--FKFLETAK-DLPTIMTSNIHCISTMMKC 106
                         79999******************.***************666666**************97..67777766.999*99999889******* PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         + +Ga +fl Kp ++e+l++
  Gorai.008G228800.3 107 IALGAVEFLKKPLSEEKLRN 126
                         *****************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521722.56E-1516134IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23003.9E-1616137No hitNo description
PROSITE profilePS5011020.59519132IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.3E-720127IPR001789Signal transduction response regulator, receiver domain
CDDcd001565.75E-821131No hitNo description
PROSITE profilePS5129414.291314373IPR017930Myb domain
SuperFamilySSF466891.79E-17315374IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.2E-26315374IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-24317371IPR006447Myb domain, plants
PfamPF002492.2E-6320369IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 563 aa     Download sequence    Send to blast
MICTTNDLSA WKDFPKGLKV LLLDEDSNSA SELKSKLEAM DYIVYTFCNE NEALSAVSSR  60
PESFHVAIVE INTNKKNGSF KFLETAKDLP TIMTSNIHCI STMMKCIALG AVEFLKKPLS  120
EEKLRNIWQH VVRKAFNAVG TDLSESVKPV KESLVSMLYL QLENGEPKNK DLDKTQDASV  180
IHENDPEPST GSDKYPAPST PQIEQGGRLS ANGDCQDHAN CSIEKESSEE DGESKSVETT  240
SDNTIAEVTI PVGQPQGPRD TMVTEEADLV DGTKGKSTTY SQTENGVNSK NSQAVAEKPS  300
TVSGIHSSCL NKANRKKSKV DWTPALHKKF VQAVDQLGID QAIPSRILEL MKIEGLTRHN  360
VASHLQKYRM HRKHILPKED DRRWPQRDQT QKSCYPHKPI IAFPSHYSNH VVPVGPLYPM  420
WGAPPYPSSI QMWGSQGYPL WQPTESWQWK PYPGVHADAW GCPVMPPPHG YSSAFTQNAS  480
VFHCSGTMDN RSGMPQNSVE HQPAEEVIDK VVKEAINKPW LPLPLGLKPP STDTVLAELS  540
KQGISTFPPH INGLNSSCHG TT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-16315375363ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012439374.10.0PREDICTED: two-component response regulator-like APRR2 isoform X2
SwissprotQ6LA431e-143APRR2_ARATH; Two-component response regulator-like APRR2
TrEMBLA0A0D2RKK70.0A0A0D2RKK7_G
STRINGVIT_02s0012g00570.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18020.61e-139ARR-B family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]